PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART08G19210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YC
Protein Properties Length: 106aa    MW: 11595.2 Da    PI: 4.6875
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART08G19210.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC1215.1e-3817230101
            NF-YC  30 lkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdel 101
                      +kadedv+mi+aeaPv++++ace+filelt r w haeenkrrtl+ksdiaaa++rt++fdflvdivprde 
  OBART08G19210.1   1 MKADEDVRMIAAEAPVVFARACEMFILELTHRGWAHAEENKRRTLQKSDIAAAIARTEVFDFLVDIVPRDEA 72 
                      9*********************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008089.1E-15154IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471136.2E-24169IPR009072Histone-fold
Gene3DG3DSA:1.10.20.104.9E-30169IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 106 aa     Download sequence    Send to blast
MKADEDVRMI AAEAPVVFAR ACEMFILELT HRGWAHAEEN KRRTLQKSDI AAAIARTEVF  60
DFLVDIVPRD EAKDAEAAAA VAAGIPHPAA GLPATDPMAY YYVQPQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_C3e-3116951119HapE
4g91_C3e-3116951119HapE
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14147RRTLQKS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2880441e-175AB288044.1 Oryza sativa Japonica Group OsHAP5D gene for HAP5 subunit of HAP complex, complete cds.
GenBankAK1085101e-175AK108510.1 Oryza sativa Japonica Group cDNA clone:002-144-A03, full insert sequence.
GenBankAP0003641e-175AP000364.1 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0026F07.
GenBankAP0051481e-175AP005148.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:B1142B04.
GenBankAP0149641e-175AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankCP0126161e-175CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
GenBankCT8289521e-175CT828952.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN028G23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648381.13e-71PREDICTED: nuclear transcription factor Y subunit C-2
SwissprotQ8LCG71e-43NFYC2_ARATH; Nuclear transcription factor Y subunit C-2
SwissprotQ9SMP03e-43NFYC1_ARATH; Nuclear transcription factor Y subunit C-1
TrEMBLA0A0D3H1Q81e-71A0A0D3H1Q8_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0IDS04e-71A0A0E0IDS0_ORYNI; Uncharacterized protein
TrEMBLA2YWL94e-71A2YWL9_ORYSI; Putative uncharacterized protein
TrEMBLA3BUG31e-71A3BUG3_ORYSJ; Uncharacterized protein
TrEMBLI1QJT44e-71I1QJT4_ORYGL; Uncharacterized protein
TrEMBLQ9XE334e-71Q9XE33_ORYSJ; HAP5 subunit of HAP complex
STRINGBGIOSGA028921-PA1e-70(Oryza sativa Indica Group)
STRINGLOC_Os08g38780.11e-70(Oryza sativa Japonica Group)
STRINGORGLA08G0168500.11e-70(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38563676
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56170.21e-40nuclear factor Y, subunit C2